SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1mh3a2 (1mh3 A:1-366)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2144348Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
    contains a few additional helices in the C-terminal extension; homologous to thiaminase I
  7. 2144366Species Escherichia coli [TaxId:562] [53863] (65 PDB entries)
    Uniprot P02928
  8. 2144437Domain d1mh3a2: 1mh3 A:1-366 [79113]
    Other proteins in same PDB: d1mh3a1
    chimera with yeast a1 homeodomain

Details for d1mh3a2

PDB Entry: 1mh3 (more details), 2.1 Å

PDB Description: maltose binding-a1 homeodomain protein chimera, crystal form I
PDB Compounds: (A:) maltose binding-a1 homeodomain protein chimera

SCOPe Domain Sequences for d1mh3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mh3a2 c.94.1.1 (A:1-366) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdaa
laaaqt

SCOPe Domain Coordinates for d1mh3a2:

Click to download the PDB-style file with coordinates for d1mh3a2.
(The format of our PDB-style files is described here.)

Timeline for d1mh3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mh3a1