SCOPe 2.03: Domain d1mh3a1: 1mh3 A:472-526

Lineage for d1mh3a1 (1mh3 A:472-526)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein Mating type protein A1 Homeodomain [46693] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46694] (6 PDB entries)

8. Domain d1mh3a1: 1mh3 A:472-526 [79112]
   Other proteins in same PDB: d1mh3a2
   chimera with maltose-binding protein

Details for d1mh3a1

PDB Entry: 1mh3, 2.1 Å

PDB Description: maltose binding-a1 homeodomain protein chimera, crystal form i

PDB Compounds: (A:) maltose binding-a1 homeodomain protein chimera

SCOPe Domain Sequences for d1mh3a1:

Sequence; same for both SEQRES and ATOM records:

>d1mh3a1 a.4.1.1 (A:472-526) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aaaaaispqarafleqvfrrkqslnskekeevakkcgitplqvrvwfinkrmrsk

Timeline for d1mh3a1:

• d1mh3a1 first appeared in SCOP 1.63
  
• d1mh3a1 appears in SCOPe 2.02
  
• d1mh3a1 appears in SCOPe 2.04
  
• d1mh3a1 appears in the current release, SCOPe 2.08