Lineage for d1mh3a1 (1mh3 A:472-526)
- Root: SCOP 1.65
Class a: All alpha proteins [46456] (179 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.1: Homeodomain-like [46689] (11 families) 
consists only of helices
Family a.4.1.1: Homeodomain [46690] (21 proteins) 
Protein Mating type protein A1 Homeodomain [46693] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46694] (6 PDB entries) 
Domain d1mh3a1: 1mh3 A:472-526 [79112]
Other proteins in same PDB: d1mh3a2
chimera with maltose-binding protein
mutant
Details for d1mh3a1
PDB Entry: 1mh3 (more details), 2.1 Å
PDB Description: maltose binding-a1 homeodomain protein chimera, crystal form i
SCOP Domain Sequences for d1mh3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mh3a1 a.4.1.1 (A:472-526) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae)}
aaaaaispqarafleqvfrrkqslnskekeevakkcgitplqvrvwfinkrmrsk
SCOP Domain Coordinates for d1mh3a1:
Click to download the PDB-style file with coordinates for d1mh3a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mh3a1:
- d1mh3a1 first appeared in SCOP 1.63
- d1mh3a1 appears in SCOP 1.67
- d1mh3a1 appears in the current release, SCOPe 2.08
View in 3D
