Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.1: Microbial ribonucleases [53932] (1 superfamily) single helix packs against antiparallel beta-sheet |
Superfamily d.1.1: Microbial ribonucleases [53933] (3 families) |
Family d.1.1.2: Bacterial ribonucleases [81307] (4 proteins) |
Protein Cytotoxic RNase Sa3 [82563] (1 species) |
Species Streptomyces aureofaciens [TaxId:1894] [82564] (2 PDB entries) |
Domain d1mgwa_: 1mgw A: [79109] complexed with li |
PDB Entry: 1mgw (more details), 2 Å
SCOP Domain Sequences for d1mgwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mgwa_ d.1.1.2 (A:) Cytotoxic RNase Sa3 {Streptomyces aureofaciens} asvkavgrvcysalpsqahdtldlideggpfpysqdgvvfqnregllpahstgyyheytv itpgsptrgarriitgqqwqedyytadhyasfrrvdfac
Timeline for d1mgwa_: