Lineage for d1mgwa_ (1mgw A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 405195Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 405196Superfamily d.1.1: Microbial ribonucleases [53933] (3 families) (S)
  5. 405197Family d.1.1.2: Bacterial ribonucleases [81307] (4 proteins)
  6. 405304Protein Cytotoxic RNase Sa3 [82563] (1 species)
  7. 405305Species Streptomyces aureofaciens [TaxId:1894] [82564] (2 PDB entries)
  8. 405307Domain d1mgwa_: 1mgw A: [79109]
    complexed with li

Details for d1mgwa_

PDB Entry: 1mgw (more details), 2 Å

PDB Description: Crystal structure of RNase Sa3, cytotoxic microbial ribonuclease

SCOP Domain Sequences for d1mgwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mgwa_ d.1.1.2 (A:) Cytotoxic RNase Sa3 {Streptomyces aureofaciens}
asvkavgrvcysalpsqahdtldlideggpfpysqdgvvfqnregllpahstgyyheytv
itpgsptrgarriitgqqwqedyytadhyasfrrvdfac

SCOP Domain Coordinates for d1mgwa_:

Click to download the PDB-style file with coordinates for d1mgwa_.
(The format of our PDB-style files is described here.)

Timeline for d1mgwa_: