Lineage for d1mgva_ (1mgv A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 318664Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 318665Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 319036Family c.67.1.4: GABA-aminotransferase-like [53417] (12 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 319061Protein Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA [53438] (1 species)
    synonym: 7,8-diaminopelargonic acid synthase
  7. 319062Species Escherichia coli [TaxId:562] [53439] (6 PDB entries)
  8. 319067Domain d1mgva_: 1mgv A: [79107]

Details for d1mgva_

PDB Entry: 1mgv (more details), 2.1 Å

PDB Description: crystal structure of the r391a mutant of 7,8-diaminopelargonic acid synthase

SCOP Domain Sequences for d1mgva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mgva_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli}
mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
kmalqywqakgearqrfltfrngyhgdtfgamsvcdpdnsmhslwkgylpenlfapapqs
rmdgewderdmvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregi
lliadeiatgfgrtgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisnge
agcfmhgptfmgnplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvr
vlgaigvvetthpvnmaalqkffveqgvwiapfgkliylmppyiilpqqlqrltaavnra
vqdetffc

SCOP Domain Coordinates for d1mgva_:

Click to download the PDB-style file with coordinates for d1mgva_.
(The format of our PDB-style files is described here.)

Timeline for d1mgva_: