Lineage for d1mgoa2 (1mgo A:164-339)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2449373Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (17 proteins)
    N-terminal all-beta domain defines family
  6. 2449394Protein Alcohol dehydrogenase [51737] (9 species)
  7. 2449411Species Horse (Equus caballus) [TaxId:9796] [51738] (52 PDB entries)
    Uniprot P00327
  8. 2449426Domain d1mgoa2: 1mgo A:164-339 [79095]
    Other proteins in same PDB: d1mgoa1, d1mgob1
    complexed with mpd, nad, pfb, zn; mutant

Details for d1mgoa2

PDB Entry: 1mgo (more details), 1.2 Å

PDB Description: horse liver alcohol dehydrogenase phe93ala mutant
PDB Compounds: (A:) alcohol dehydrogenase e chain

SCOPe Domain Sequences for d1mgoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mgoa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
splekvcligcgfstgygsavkvakvtqgstcavfglggvglsvimgckaagaariigvd
inkdkfakakevgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccq
eaygvsvivgvppdsqnlsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakk

SCOPe Domain Coordinates for d1mgoa2:

Click to download the PDB-style file with coordinates for d1mgoa2.
(The format of our PDB-style files is described here.)

Timeline for d1mgoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mgoa1