SCOPe 2.04: Domain d1mgoa1: 1mgo A:1-163,A:340-374

Lineage for d1mgoa1 (1mgo A:1-163,A:340-374)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Alcohol dehydrogenase [50137] (9 species)
   contains a Zn-finger subdomain, residues 94-117

7. Species Horse (Equus caballus) [TaxId:9796] [50138] (40 PDB entries)
   Uniprot P00327

8. Domain d1mgoa1: 1mgo A:1-163,A:340-374 [79094]
   Other proteins in same PDB: d1mgoa2, d1mgob2
   complexed with mpd, nad, pfb, zn; mutant

Details for d1mgoa1

PDB Entry: 1mgo, 1.2 Å

PDB Description: horse liver alcohol dehydrogenase phe93ala mutant

PDB Compounds: (A:) alcohol dehydrogenase e chain

SCOPe Domain Sequences for d1mgoa1:

Sequence; same for both SEQRES and ATOM records:

>d1mgoa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplatpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfeki
negfdllrsgesirtiltf

Timeline for d1mgoa1:

• d1mgoa1 first appeared in SCOP 1.63
  
• d1mgoa1 appears in SCOPe 2.03
  
• d1mgoa1 appears in SCOPe 2.05
  
• d1mgoa1 appears in the current release, SCOPe 2.08