Lineage for d1mg9b_ (1mg9 B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.174: Double Clp-N motif [81922] (1 superfamily)
    multihelical; array
  4. Superfamily a.174.1: Double Clp-N motif [81923] (2 families) (S)
    duplication: contains two structural repeats of 4-helical motif
  5. Family a.174.1.1: Double Clp-N motif [81924] (3 proteins)
  6. Protein N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone [81925] (1 species)
  7. Species Escherichia coli [TaxId:562] [81926] (8 PDB entries)
    Uniprot Q83LR6
  8. Domain d1mg9b_: 1mg9 B: [79093]
    Other proteins in same PDB: d1mg9a_
    complex with ClpS
    complexed with spk

Details for d1mg9b_

PDB Entry: 1mg9 (more details), 2.3 Å

PDB Description: the structural basis of clps-mediated switch in clpa substrate recognition
PDB Compounds: (B:) ATP dependent clp protease ATP-binding subunit clpA

SCOPe Domain Sequences for d1mg9b_:

Sequence, based on SEQRES records: (download)

>d1mg9b_ a.174.1.1 (B:) N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone {Escherichia coli [TaxId: 562]}
mlnqelelslnmafararehrhefmtvehlllallsnpsarealeacsvdlvalrqelea
fieqttpvlpaseeerdtqptlsfqrvlqravfhvqssgrnevtganvlvaifseqesqa
ayllrkhevsrldvvnfishgtrkde

Sequence, based on observed residues (ATOM records): (download)

>d1mg9b_ a.174.1.1 (B:) N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone {Escherichia coli [TaxId: 562]}
mlnqelelslnmafararehrhefmtvehlllallsnpsarealeacsvdlvalrqelea
fieqttpvlpasrdtqptlsfqrvlqravfhvqssgrnevtganvlvaifseqesqaayl
lrkhevsrldvvnfishgtrkde

SCOPe Domain Coordinates for d1mg9b_ are not available.

Timeline for d1mg9b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mg9a_