Class a: All alpha proteins [46456] (286 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
Protein Snake phospholipase A2 [48624] (36 species) |
Species Hundred-pace snake (Agkistrodon acutus) [TaxId:36307] [74796] (2 PDB entries) monomeric Lys-49 phospholipase A2 homologue |
Domain d1mg6a_: 1mg6 A: [79091] |
PDB Entry: 1mg6 (more details), 1.6 Å
SCOPe Domain Sequences for d1mg6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mg6a_ a.133.1.2 (A:) Snake phospholipase A2 {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} slfelgkmiwqetgknpvknyglygcncgvggrgepldatdrccfvhkccykkltdcdsk kdrysykwknkaivcgknqpcmqemcecdkafaiclrenldtynksfryhlkpsckktse qc
Timeline for d1mg6a_: