Lineage for d1mg6a_ (1mg6 A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 361220Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 361221Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 361226Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 361305Protein Snake phospholipase A2 [48624] (33 species)
  7. 361348Species Hundred-pace snake (Agkistrodon acutus) [TaxId:36307] [74796] (2 PDB entries)
    monomeric Lys-49 phospholipase A2 homologue
  8. 361350Domain d1mg6a_: 1mg6 A: [79091]

Details for d1mg6a_

PDB Entry: 1mg6 (more details), 1.6 Å

PDB Description: the crystal structure of a k49 pla2 from the snake venom of agkistrodon acutus

SCOP Domain Sequences for d1mg6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mg6a_ a.133.1.2 (A:) Snake phospholipase A2 {Hundred-pace snake (Agkistrodon acutus)}
slfelgkmiwqetgknpvknyglygcncgvggrgepldatdrccfvhkccykkltdcdsk
kdrysykwknkaivcgknqpcmqemcecdkafaiclrenldtynksfryhlkpsckktse
qc

SCOP Domain Coordinates for d1mg6a_:

Click to download the PDB-style file with coordinates for d1mg6a_.
(The format of our PDB-style files is described here.)

Timeline for d1mg6a_: