Lineage for d1mg3o_ (1mg3 O:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 940170Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 940171Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 940172Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 940173Protein Amicyanin [49505] (2 species)
  7. 940174Species Paracoccus denitrificans [TaxId:266] [49506] (33 PDB entries)
    Uniprot P22364
  8. 940230Domain d1mg3o_: 1mg3 O: [79089]
    Other proteins in same PDB: d1mg3a_, d1mg3b_, d1mg3d_, d1mg3e_, d1mg3f_, d1mg3h_, d1mg3i_, d1mg3j_, d1mg3l_, d1mg3m_, d1mg3n_, d1mg3p_
    complexed with cu, hem, na, po4; mutant

Details for d1mg3o_

PDB Entry: 1mg3 (more details), 2.4 Å

PDB Description: mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin
PDB Compounds: (O:) amicyanin

SCOPe Domain Sequences for d1mg3o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mg3o_ b.6.1.1 (O:) Amicyanin {Paracoccus denitrificans [TaxId: 266]}
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve

SCOPe Domain Coordinates for d1mg3o_:

Click to download the PDB-style file with coordinates for d1mg3o_.
(The format of our PDB-style files is described here.)

Timeline for d1mg3o_: