Lineage for d1mg3j_ (1mg3 J:)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 343563Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulphide-rich; nearly all-beta
  4. 343564Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (1 family) (S)
  5. 343565Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (1 protein)
  6. 343566Protein Methylamine dehydrogenase [57563] (2 species)
  7. 343571Species Paracoccus denitrificans [TaxId:266] [57564] (5 PDB entries)
  8. 343581Domain d1mg3j_: 1mg3 J: [79084]
    Other proteins in same PDB: d1mg3a_, d1mg3c_, d1mg3d_, d1mg3e_, d1mg3g_, d1mg3h_, d1mg3i_, d1mg3k_, d1mg3l_, d1mg3m_, d1mg3o_, d1mg3p_

Details for d1mg3j_

PDB Entry: 1mg3 (more details), 2.4 Å

PDB Description: mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin

SCOP Domain Sequences for d1mg3j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mg3j_ g.21.1.1 (J:) Methylamine dehydrogenase {Paracoccus denitrificans}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOP Domain Coordinates for d1mg3j_:

Click to download the PDB-style file with coordinates for d1mg3j_.
(The format of our PDB-style files is described here.)

Timeline for d1mg3j_: