Class a: All alpha proteins [46456] (284 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
Protein Cytochrome c551 [46660] (4 species) |
Species Paracoccus denitrificans [TaxId:266] [46663] (5 PDB entries) |
Domain d1mg3h_: 1mg3 H: [79082] Other proteins in same PDB: d1mg3a_, d1mg3b_, d1mg3c_, d1mg3e_, d1mg3f_, d1mg3g_, d1mg3i_, d1mg3j_, d1mg3k_, d1mg3m_, d1mg3n_, d1mg3o_ complexed with cu, hem, na, po4; mutant |
PDB Entry: 1mg3 (more details), 2.4 Å
SCOPe Domain Sequences for d1mg3h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mg3h_ a.3.1.1 (H:) Cytochrome c551 {Paracoccus denitrificans [TaxId: 266]} apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv rhlytgdpkdaswltdeqkagftpfqp
Timeline for d1mg3h_: