Lineage for d1mg3h_ (1mg3 H:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2690878Protein Cytochrome c551 [46660] (5 species)
  7. 2690881Species Paracoccus denitrificans [TaxId:266] [46663] (5 PDB entries)
  8. 2690895Domain d1mg3h_: 1mg3 H: [79082]
    Other proteins in same PDB: d1mg3a_, d1mg3b_, d1mg3c_, d1mg3e_, d1mg3f_, d1mg3g_, d1mg3i_, d1mg3j_, d1mg3k_, d1mg3m_, d1mg3n_, d1mg3o_
    complexed with cu, hec, na, po4; mutant

Details for d1mg3h_

PDB Entry: 1mg3 (more details), 2.4 Å

PDB Description: mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin
PDB Compounds: (H:) cytochrome c-l

SCOPe Domain Sequences for d1mg3h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mg3h_ a.3.1.1 (H:) Cytochrome c551 {Paracoccus denitrificans [TaxId: 266]}
apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc
hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv
rhlytgdpkdaswltdeqkagftpfqp

SCOPe Domain Coordinates for d1mg3h_:

Click to download the PDB-style file with coordinates for d1mg3h_.
(The format of our PDB-style files is described here.)

Timeline for d1mg3h_: