![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
![]() | Protein Amicyanin [49505] (2 species) |
![]() | Species Paracoccus denitrificans [TaxId:266] [49506] (35 PDB entries) Uniprot P22364 |
![]() | Domain d1mg3g_: 1mg3 G: [79081] Other proteins in same PDB: d1mg3a_, d1mg3b_, d1mg3d_, d1mg3e_, d1mg3f_, d1mg3h_, d1mg3i_, d1mg3j_, d1mg3l_, d1mg3m_, d1mg3n_, d1mg3p_ complexed with cu, hem, na, po4; mutant |
PDB Entry: 1mg3 (more details), 2.4 Å
SCOPe Domain Sequences for d1mg3g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mg3g_ b.6.1.1 (G:) Amicyanin {Paracoccus denitrificans [TaxId: 266]} dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve
Timeline for d1mg3g_: