Lineage for d1mg3g_ (1mg3 G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770401Protein Amicyanin [49505] (2 species)
  7. 2770402Species Paracoccus denitrificans [TaxId:266] [49506] (35 PDB entries)
    Uniprot P22364
  8. 2770458Domain d1mg3g_: 1mg3 G: [79081]
    Other proteins in same PDB: d1mg3a_, d1mg3b_, d1mg3d_, d1mg3e_, d1mg3f_, d1mg3h_, d1mg3i_, d1mg3j_, d1mg3l_, d1mg3m_, d1mg3n_, d1mg3p_
    complexed with cu, hec, na, po4; mutant

Details for d1mg3g_

PDB Entry: 1mg3 (more details), 2.4 Å

PDB Description: mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin
PDB Compounds: (G:) amicyanin

SCOPe Domain Sequences for d1mg3g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mg3g_ b.6.1.1 (G:) Amicyanin {Paracoccus denitrificans [TaxId: 266]}
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve

SCOPe Domain Coordinates for d1mg3g_:

Click to download the PDB-style file with coordinates for d1mg3g_.
(The format of our PDB-style files is described here.)

Timeline for d1mg3g_: