Lineage for d1mg3e_ (1mg3 E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2418201Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2418231Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families) (S)
  5. 2418232Family b.69.2.1: Methylamine dehydrogenase, H-chain [50970] (1 protein)
    less regular propeller without notable sequence repeats; quinone cofactor is a tryptophan derivative in another subunit
    automatically mapped to Pfam PF06433

    this is a repeat family; one repeat unit is 1mg2 A:132-178 found in domain
  6. 2418233Protein Methylamine dehydrogenase, H-chain [50971] (2 species)
  7. 2418234Species Paracoccus denitrificans [TaxId:266] [50972] (5 PDB entries)
  8. 2418243Domain d1mg3e_: 1mg3 E: [79079]
    Other proteins in same PDB: d1mg3b_, d1mg3c_, d1mg3d_, d1mg3f_, d1mg3g_, d1mg3h_, d1mg3j_, d1mg3k_, d1mg3l_, d1mg3n_, d1mg3o_, d1mg3p_
    complexed with cu, hem, na, po4; mutant

Details for d1mg3e_

PDB Entry: 1mg3 (more details), 2.4 Å

PDB Description: mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin
PDB Compounds: (E:) Methylamine dehydrogenase, heavy chain

SCOPe Domain Sequences for d1mg3e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mg3e_ b.69.2.1 (E:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}
eaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahaaavtqqfvi
dgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptad
ielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhi
fptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwpt
ytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdew
rhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesg
eelrsvnqlghgpqvittadmg

SCOPe Domain Coordinates for d1mg3e_:

Click to download the PDB-style file with coordinates for d1mg3e_.
(The format of our PDB-style files is described here.)

Timeline for d1mg3e_: