![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families) ![]() |
![]() | Family b.69.2.1: Methylamine dehydrogenase, H-chain [50970] (1 protein) less regular propeller without notable sequence repeats; quinone cofactor is a tryptophan derivative in another subunit automatically mapped to Pfam PF06433 this is a repeat family; one repeat unit is 1mg2 A:132-178 found in domain |
![]() | Protein Methylamine dehydrogenase, H-chain [50971] (2 species) |
![]() | Species Paracoccus denitrificans [TaxId:266] [50972] (5 PDB entries) |
![]() | Domain d1mg3a_: 1mg3 A: [79075] Other proteins in same PDB: d1mg3b_, d1mg3c_, d1mg3d_, d1mg3f_, d1mg3g_, d1mg3h_, d1mg3j_, d1mg3k_, d1mg3l_, d1mg3n_, d1mg3o_, d1mg3p_ complexed with cu, hem, na, po4; mutant |
PDB Entry: 1mg3 (more details), 2.4 Å
SCOPe Domain Sequences for d1mg3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mg3a_ b.69.2.1 (A:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} eaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahaaavtqqfvi dgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptad ielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhi fptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwpt ytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdew rhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesg eelrsvnqlghgpqvittadmg
Timeline for d1mg3a_: