Lineage for d1mg2p_ (1mg2 P:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2304254Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2304334Protein Cytochrome c551 [46660] (5 species)
  7. 2304337Species Paracoccus denitrificans [TaxId:266] [46663] (5 PDB entries)
  8. 2304350Domain d1mg2p_: 1mg2 P: [79074]
    Other proteins in same PDB: d1mg2a_, d1mg2b_, d1mg2c_, d1mg2e_, d1mg2f_, d1mg2g_, d1mg2i_, d1mg2j_, d1mg2k_, d1mg2m_, d1mg2n_, d1mg2o_
    complexed with cu, hem, na, po4; mutant

Details for d1mg2p_

PDB Entry: 1mg2 (more details), 2.25 Å

PDB Description: mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin
PDB Compounds: (P:) cytochrome c-l

SCOPe Domain Sequences for d1mg2p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mg2p_ a.3.1.1 (P:) Cytochrome c551 {Paracoccus denitrificans [TaxId: 266]}
apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc
hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv
rhlytgdpkdaswltdeqkagftpfqp

SCOPe Domain Coordinates for d1mg2p_:

Click to download the PDB-style file with coordinates for d1mg2p_.
(The format of our PDB-style files is described here.)

Timeline for d1mg2p_: