![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
![]() | Protein Amicyanin [49505] (2 species) |
![]() | Species Paracoccus denitrificans [TaxId:266] [49506] (35 PDB entries) Uniprot P22364 |
![]() | Domain d1mg2o_: 1mg2 O: [79073] Other proteins in same PDB: d1mg2a_, d1mg2b_, d1mg2d_, d1mg2e_, d1mg2f_, d1mg2h_, d1mg2i_, d1mg2j_, d1mg2l_, d1mg2m_, d1mg2n_, d1mg2p_ complexed with cu, hec, na, po4; mutant |
PDB Entry: 1mg2 (more details), 2.25 Å
SCOPe Domain Sequences for d1mg2o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mg2o_ b.6.1.1 (O:) Amicyanin {Paracoccus denitrificans [TaxId: 266]} dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve
Timeline for d1mg2o_: