Class b: All beta proteins [48724] (174 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (3 families) |
Family b.69.2.1: Methylamine dehydrogenase, H-chain [50970] (1 protein) less regular propeller without notable sequence repeats; quinone cofactor is a tryptophan derivative in another subunit this is a repeat family; one repeat unit is 1mg2 A:132-178 found in domain |
Protein Methylamine dehydrogenase, H-chain [50971] (2 species) |
Species Paracoccus denitrificans [TaxId:266] [50972] (10 PDB entries) |
Domain d1mg2m_: 1mg2 M: [79071] Other proteins in same PDB: d1mg2b_, d1mg2c_, d1mg2d_, d1mg2f_, d1mg2g_, d1mg2h_, d1mg2j_, d1mg2k_, d1mg2l_, d1mg2n_, d1mg2o_, d1mg2p_ complexed with cu, hem, na, po4, trq; mutant |
PDB Entry: 1mg2 (more details), 2.25 Å
SCOP Domain Sequences for d1mg2m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mg2m_ b.69.2.1 (M:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} eaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahaaavtqqfvi dgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptad ielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhi fptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwpt ytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdew rhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesg eelrsvnqlghgpqvittadmg
Timeline for d1mg2m_: