Lineage for d1mg2j_ (1mg2 J:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034451Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 3034452Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 3034453Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 3034454Protein Methylamine dehydrogenase [57563] (2 species)
  7. 3034455Species Paracoccus denitrificans [TaxId:266] [57564] (24 PDB entries)
  8. 3034486Domain d1mg2j_: 1mg2 J: [79068]
    Other proteins in same PDB: d1mg2a_, d1mg2c_, d1mg2d_, d1mg2e_, d1mg2g_, d1mg2h_, d1mg2i_, d1mg2k_, d1mg2l_, d1mg2m_, d1mg2o_, d1mg2p_
    complexed with cu, hec, na, po4; mutant

Details for d1mg2j_

PDB Entry: 1mg2 (more details), 2.25 Å

PDB Description: mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin
PDB Compounds: (J:) Methylamine dehydrogenase, light chain

SCOPe Domain Sequences for d1mg2j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mg2j_ g.21.1.1 (J:) Methylamine dehydrogenase {Paracoccus denitrificans [TaxId: 266]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOPe Domain Coordinates for d1mg2j_:

Click to download the PDB-style file with coordinates for d1mg2j_.
(The format of our PDB-style files is described here.)

Timeline for d1mg2j_: