Lineage for d1mfua1 (1mfu A:404-491)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 675781Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 675782Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 675783Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 675812Protein Animal alpha-amylase [51024] (3 species)
  7. 675813Species Human (Homo sapiens) [TaxId:9606] [51026] (33 PDB entries)
  8. 675823Domain d1mfua1: 1mfu A:404-491 [79047]
    Other proteins in same PDB: d1mfua2
    complexed with agl, ca, cl, glc, hmc, pca; mutant

Details for d1mfua1

PDB Entry: 1mfu (more details), 2 Å

PDB Description: probing the role of a mobile loop in human salivary amylase: structural studies on the loop-deleted mutant
PDB Compounds: (A:) Alpha-amylase, salivary

SCOP Domain Sequences for d1mfua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfua1 b.71.1.1 (A:404-491) Animal alpha-amylase {Human (Homo sapiens) [TaxId: 9606]}
wydngsnqvafgrgnrgfivfnnddwtfsltlqtglpagtycdvisgdkingnctgikiy
vsddgkahfsisnsaedpfiaihaeskl

SCOP Domain Coordinates for d1mfua1:

Click to download the PDB-style file with coordinates for d1mfua1.
(The format of our PDB-style files is described here.)

Timeline for d1mfua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mfua2