SCOP 1.69: Domain d1mfua1: 1mfu A:404-491

Lineage for d1mfua1 (1mfu A:404-491)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Animal alpha-amylase [51024] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51026] (23 PDB entries)

8. Domain d1mfua1: 1mfu A:404-491 [79047]
   Other proteins in same PDB: d1mfua2

Details for d1mfua1

PDB Entry: 1mfu, 2 Å

PDB Description: probing the role of a mobile loop in human salivary amylase: structural studies on the loop-deleted mutant

SCOP Domain Sequences for d1mfua1:

Sequence; same for both SEQRES and ATOM records:

>d1mfua1 b.71.1.1 (A:404-491) Animal alpha-amylase {Human (Homo sapiens)}
wydngsnqvafgrgnrgfivfnnddwtfsltlqtglpagtycdvisgdkingnctgikiy
vsddgkahfsisnsaedpfiaihaeskl

Timeline for d1mfua1:

• d1mfua1 first appeared in SCOP 1.63
  
• d1mfua1 appears in SCOP 1.67
  
• d1mfua1 appears in SCOP 1.71
  
• d1mfua1 appears in the current release, SCOPe 2.08