| Class b: All beta proteins [48724] (144 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
| Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins) this domain follows the catalytic beta/alpha barrel domain |
| Protein Animal alpha-amylase [51024] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [51026] (23 PDB entries) |
| Domain d1mfua1: 1mfu A:404-491 [79047] Other proteins in same PDB: d1mfua2 |
PDB Entry: 1mfu (more details), 2 Å
SCOP Domain Sequences for d1mfua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mfua1 b.71.1.1 (A:404-491) Animal alpha-amylase {Human (Homo sapiens)}
wydngsnqvafgrgnrgfivfnnddwtfsltlqtglpagtycdvisgdkingnctgikiy
vsddgkahfsisnsaedpfiaihaeskl
Timeline for d1mfua1: