SCOPe 2.02: Domain d1mfqc_: 1mfq C:

Lineage for d1mfqc_ (1mfq C:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.36: Signal peptide-binding domain [47445] (1 superfamily)
   4 helices; orthogonal array

4. Superfamily a.36.1: Signal peptide-binding domain [47446] (1 family)

5. Family a.36.1.1: Signal peptide-binding domain [47447] (2 proteins)

6. Protein SRP54M [47451] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47452] (3 PDB entries)

8. Domain d1mfqc_: 1mfq C: [79046]
   Other proteins in same PDB: d1mfqb_
   a part of a ternary s-domain complex
   protein/RNA complex; complexed with cl, mg

Details for d1mfqc_

PDB Entry: 1mfq, 3.1 Å

PDB Description: Crystal Structure Analysis of a Ternary S-Domain Complex of Human Signal Recognition Particle

PDB Compounds: (C:) signal recognition particle 54kDa protein

SCOPe Domain Sequences for d1mfqc_:

Sequence, based on SEQRES records:

>d1mfqc_ a.36.1.1 (C:) SRP54M {Human (Homo sapiens) [TaxId: 9606]}
khgqftlrdmyeqfqnimkmgpfsqilgmipgfgtdfmskgneqesmarlkklmtimdsm
ndqeldstdgakvfskqpgriqrvargsgvstrdvqelltqytkfaqmvkkmggik

Sequence, based on observed residues (ATOM records):

>d1mfqc_ a.36.1.1 (C:) SRP54M {Human (Homo sapiens) [TaxId: 9606]}
khgqftlrdmyeqfqnimkmgpfsqilgmipgfneqesmarlkklmtimdsmndqeldst
dgakvfskqpgriqrvargsgvstrdvqelltqytkfaqmvkkmggik

Timeline for d1mfqc_:

• d1mfqc_ first appeared in SCOP 1.63
  
• d1mfqc_ appears in SCOPe 2.01
  
• d1mfqc_ appears in SCOPe 2.03
  
• d1mfqc_ appears in the current release, SCOPe 2.08