Class a: All alpha proteins [46456] (179 folds) |
Fold a.36: Signal peptide-binding domain [47445] (1 superfamily) 4 helices; orthogonal array |
Superfamily a.36.1: Signal peptide-binding domain [47446] (1 family) |
Family a.36.1.1: Signal peptide-binding domain [47447] (2 proteins) |
Protein SRP54M [47451] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47452] (2 PDB entries) |
Domain d1mfqc_: 1mfq C: [79046] Other proteins in same PDB: d1mfqb_ a part of a ternary s-domain complex complexed with ccc, cl, mg |
PDB Entry: 1mfq (more details), 3.1 Å
SCOP Domain Sequences for d1mfqc_:
Sequence, based on SEQRES records: (download)
>d1mfqc_ a.36.1.1 (C:) SRP54M {Human (Homo sapiens)} khgqftlrdmyeqfqnimkmgpfsqilgmipgfgtdfmskgneqesmarlkklmtimdsm ndqeldstdgakvfskqpgriqrvargsgvstrdvqelltqytkfaqmvkkmggik
>d1mfqc_ a.36.1.1 (C:) SRP54M {Human (Homo sapiens)} khgqftlrdmyeqfqnimkmgpfsqilgmipgfneqesmarlkklmtimdsmndqeldst dgakvfskqpgriqrvargsgvstrdvqelltqytkfaqmvkkmggik
Timeline for d1mfqc_: