Lineage for d1mfqb_ (1mfq B:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 337899Fold d.201: SRP19 [69694] (1 superfamily)
    beta-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 337900Superfamily d.201.1: SRP19 [69695] (1 family) (S)
  5. 337901Family d.201.1.1: SRP19 [69696] (1 protein)
  6. 337902Protein SRP19 [69697] (3 species)
  7. 337909Species Human (Homo sapiens) [TaxId:9606] [69698] (2 PDB entries)
  8. 337911Domain d1mfqb_: 1mfq B: [79045]
    Other proteins in same PDB: d1mfqc_
    a part of a ternary s-domain complex
    complexed with ccc, cl, mg

Details for d1mfqb_

PDB Entry: 1mfq (more details), 3.1 Å

PDB Description: Crystal Structure Analysis of a Ternary S-Domain Complex of Human Signal Recognition Particle

SCOP Domain Sequences for d1mfqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfqb_ d.201.1.1 (B:) SRP19 {Human (Homo sapiens)}
rficiypaylnnkktiaegrripiskavenptateiqdvcsavglnvfleknkmysrewn
rdvqyrgrvrvqlkqedgslclvqfpsrksvmlyaaemipklktrtq

SCOP Domain Coordinates for d1mfqb_:

Click to download the PDB-style file with coordinates for d1mfqb_.
(The format of our PDB-style files is described here.)

Timeline for d1mfqb_: