| Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
| Fold d.201: SRP19 [69694] (1 superfamily) beta-alpha-beta(2)-alpha; 2 layers: alpha/beta |
Superfamily d.201.1: SRP19 [69695] (1 family) ![]() |
| Family d.201.1.1: SRP19 [69696] (1 protein) |
| Protein SRP19 [69697] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [69698] (2 PDB entries) |
| Domain d1mfqb_: 1mfq B: [79045] Other proteins in same PDB: d1mfqc_ a part of a ternary s-domain complex complexed with ccc, cl, mg |
PDB Entry: 1mfq (more details), 3.1 Å
SCOP Domain Sequences for d1mfqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mfqb_ d.201.1.1 (B:) SRP19 {Human (Homo sapiens)}
rficiypaylnnkktiaegrripiskavenptateiqdvcsavglnvfleknkmysrewn
rdvqyrgrvrvqlkqedgslclvqfpsrksvmlyaaemipklktrtq
Timeline for d1mfqb_: