SCOPe 2.08: Domain d1mfqb_: 1mfq B:

Lineage for d1mfqb_ (1mfq B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.201: SRP19 [69694] (1 superfamily)
   beta-alpha-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.201.1: SRP19 [69695] (2 families)
   automatically mapped to Pfam PF01922

5. Family d.201.1.1: SRP19 [69696] (1 protein)

6. Protein SRP19 [69697] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69698] (4 PDB entries)

8. Domain d1mfqb_: 1mfq B: [79045]
   Other proteins in same PDB: d1mfqc_
   a part of a ternary s-domain complex
   protein/RNA complex; complexed with cl, mg

Details for d1mfqb_

PDB Entry: 1mfq, 3.1 Å

PDB Description: Crystal Structure Analysis of a Ternary S-Domain Complex of Human Signal Recognition Particle

PDB Compounds: (B:) signal recognition particle 19kDa protein

SCOPe Domain Sequences for d1mfqb_:

Sequence; same for both SEQRES and ATOM records:

>d1mfqb_ d.201.1.1 (B:) SRP19 {Human (Homo sapiens) [TaxId: 9606]}
rficiypaylnnkktiaegrripiskavenptateiqdvcsavglnvfleknkmysrewn
rdvqyrgrvrvqlkqedgslclvqfpsrksvmlyaaemipklktrtq

Timeline for d1mfqb_:

• d1mfqb_ first appeared in SCOP 1.63
  
• d1mfqb_ appears in SCOPe 2.07