SCOPe 2.06: Domain d1mfga1: 1mfg A:1280-1371

Lineage for d1mfga1 (1mfg A:1280-1371)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Erbin [82085] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82086] (4 PDB entries)

8. Domain d1mfga1: 1mfg A:1280-1371 [79043]
   Other proteins in same PDB: d1mfga2
   complexed with the carboxy-terminal tail of the erbb2 receptor

Details for d1mfga1

PDB Entry: 1mfg, 1.25 Å

PDB Description: The Structure of ERBIN PDZ domain bound to the Carboxy-terminal tail of the ErbB2 Receptor

PDB Compounds: (A:) Erb-B2 INTERACTING PROTEIN

SCOPe Domain Sequences for d1mfga1:

Sequence; same for both SEQRES and ATOM records:

>d1mfga1 b.36.1.1 (A:1280-1371) Erbin {Human (Homo sapiens) [TaxId: 9606]}
eirvrvekdpelgfsisggvggrgnpfrpdddgifvtrvqpegpaskllqpgdkiiqang
ysfiniehgqavsllktfqntveliivrevss

Timeline for d1mfga1:

• d1mfga1 first appeared in SCOP 1.63, called d1mfga_
  
• d1mfga1 was called d1mfga_ in SCOPe 2.05
  
• d1mfga1 appears in SCOPe 2.07
  
• d1mfga1 appears in the current release, SCOPe 2.08