Class b: All beta proteins [48724] (176 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
Protein Erbin [82085] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82086] (4 PDB entries) |
Domain d1mfga_: 1mfg A: [79043] complexed with the carboxy-terminal tail of the erbb2 receptor |
PDB Entry: 1mfg (more details), 1.25 Å
SCOPe Domain Sequences for d1mfga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mfga_ b.36.1.1 (A:) Erbin {Human (Homo sapiens) [TaxId: 9606]} gsmeirvrvekdpelgfsisggvggrgnpfrpdddgifvtrvqpegpaskllqpgdkiiq angysfiniehgqavsllktfqntveliivrevss
Timeline for d1mfga_: