![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
![]() | Superfamily b.36.1: PDZ domain-like [50156] (7 families) ![]() peptide-binding domain |
![]() | Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
![]() | Protein Erbin [82085] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82086] (4 PDB entries) |
![]() | Domain d1mfga1: 1mfg A:1280-1371 [79043] Other proteins in same PDB: d1mfga2 complexed with the carboxy-terminal tail of the erbb2 receptor |
PDB Entry: 1mfg (more details), 1.25 Å
SCOPe Domain Sequences for d1mfga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mfga1 b.36.1.1 (A:1280-1371) Erbin {Human (Homo sapiens) [TaxId: 9606]} eirvrvekdpelgfsisggvggrgnpfrpdddgifvtrvqpegpaskllqpgdkiiqang ysfiniehgqavsllktfqntveliivrevss
Timeline for d1mfga1: