Lineage for d1mfga1 (1mfg A:1280-1371)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2785924Protein Erbin [82085] (1 species)
  7. 2785925Species Human (Homo sapiens) [TaxId:9606] [82086] (4 PDB entries)
  8. 2785928Domain d1mfga1: 1mfg A:1280-1371 [79043]
    Other proteins in same PDB: d1mfga2
    complexed with the carboxy-terminal tail of the erbb2 receptor

Details for d1mfga1

PDB Entry: 1mfg (more details), 1.25 Å

PDB Description: The Structure of ERBIN PDZ domain bound to the Carboxy-terminal tail of the ErbB2 Receptor
PDB Compounds: (A:) Erb-B2 INTERACTING PROTEIN

SCOPe Domain Sequences for d1mfga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfga1 b.36.1.1 (A:1280-1371) Erbin {Human (Homo sapiens) [TaxId: 9606]}
eirvrvekdpelgfsisggvggrgnpfrpdddgifvtrvqpegpaskllqpgdkiiqang
ysfiniehgqavsllktfqntveliivrevss

SCOPe Domain Coordinates for d1mfga1:

Click to download the PDB-style file with coordinates for d1mfga1.
(The format of our PDB-style files is described here.)

Timeline for d1mfga1: