Lineage for d1mf8b_ (1mf8 B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 442523Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 442524Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 442704Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
    Duplication: made with two pairs of EF-hands
  6. 442708Protein Calcineurin regulatory subunit (B-chain) [47530] (2 species)
  7. 442711Species Human (Homo sapiens) [TaxId:9606] [47532] (3 PDB entries)
  8. 442715Domain d1mf8b_: 1mf8 B: [79041]
    Other proteins in same PDB: d1mf8a_, d1mf8c_

Details for d1mf8b_

PDB Entry: 1mf8 (more details), 3.1 Å

PDB Description: Crystal Structure of human calcineurin complexed with cyclosporin A and human cyclophilin

SCOP Domain Sequences for d1mf8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mf8b_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens)}
syplemcshfdadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidifdtd
gngevdfkefiegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvgnnlk
dtqlqqivdktiinadkdgdgrisfeefcavvggldihkkmvvd

SCOP Domain Coordinates for d1mf8b_:

Click to download the PDB-style file with coordinates for d1mf8b_.
(The format of our PDB-style files is described here.)

Timeline for d1mf8b_: