Lineage for d1mf8a_ (1mf8 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998036Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2998037Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2998136Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 2998236Protein Protein phosphatase-2B (PP-2B, calcineurin A subunit) [56313] (2 species)
  7. 2998239Species Human (Homo sapiens) [TaxId:9606] [56315] (9 PDB entries)
  8. 2998250Domain d1mf8a_: 1mf8 A: [79040]
    Other proteins in same PDB: d1mf8b_, d1mf8c_
    complexed with ca, po4

Details for d1mf8a_

PDB Entry: 1mf8 (more details), 3.1 Å

PDB Description: Crystal Structure of human calcineurin complexed with cyclosporin A and human cyclophilin
PDB Compounds: (A:) calmodulin-dependent calcineurin a subunit, alpha isoform

SCOPe Domain Sequences for d1mf8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mf8a_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]}
avpfppshrltakevfdndgkprvdilkahlmkegrleesvalriitegasilrqeknll
didapvtvcgdihgqffdlmklfevggspantrylflgdyvdrgyfsiecvlylwalkil
ypktlfllrgnhecrhlteyftfkqeckikyservydacmdafdclplaalmnqqflcvh
gglspeintlddirkldrfkeppaygpmcdilwsdpledfgnektqehfthntvrgcsyf
ysypavceflqhnnllsilraheaqdagyrmyrksqttgfpslitifsapnyldvynnka
avlkyennvmnirqfncsphpywlpnfmdvftwslpfvgekvtemlvnvlni

SCOPe Domain Coordinates for d1mf8a_:

Click to download the PDB-style file with coordinates for d1mf8a_.
(The format of our PDB-style files is described here.)

Timeline for d1mf8a_: