Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.65: Formyltransferase [53327] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest |
Superfamily c.65.1: Formyltransferase [53328] (2 families) |
Family c.65.1.1: Formyltransferase [53329] (5 proteins) |
Protein Glycinamide ribonucleotide transformylase, GART [53330] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [82468] (18 PDB entries) |
Domain d1meoa_: 1meo A: [79035] complexed with po4, so4 |
PDB Entry: 1meo (more details), 1.72 Å
SCOPe Domain Sequences for d1meoa_:
Sequence, based on SEQRES records: (download)
>d1meoa_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens) [TaxId: 9606]} arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa lqlvasgtvqlgengkicwvkeehh
>d1meoa_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens) [TaxId: 9606]} arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna heqaletgvtvtgctvhfvaeagqiilqeavpvkrgdtvatlservklaehkifpaalql vasgtvqlgengkicwvkeehh
Timeline for d1meoa_: