Lineage for d1meoa_ (1meo A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 247514Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 247515Superfamily c.65.1: Formyltransferase [53328] (1 family) (S)
  5. 247516Family c.65.1.1: Formyltransferase [53329] (2 proteins)
  6. 247517Protein Glycinamide ribonucleotide transformylase, GART [53330] (2 species)
  7. 247536Species Human (Homo sapiens) [TaxId:9606] [82468] (3 PDB entries)
  8. 247537Domain d1meoa_: 1meo A: [79035]
    complexed with po4, so4

Details for d1meoa_

PDB Entry: 1meo (more details), 1.72 Å

PDB Description: human glycinamide ribonucleotide Transformylase at pH 4.2

SCOP Domain Sequences for d1meoa_:

Sequence, based on SEQRES records: (download)

>d1meoa_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens)}
arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
lqlvasgtvqlgengkicwvkeehh

Sequence, based on observed residues (ATOM records): (download)

>d1meoa_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens)}
arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
heqaletgvtvtgctvhfvaeagqiilqeavpvkrgdtvatlservklaehkifpaalql
vasgtvqlgengkicwvkeehh

SCOP Domain Coordinates for d1meoa_:

Click to download the PDB-style file with coordinates for d1meoa_.
(The format of our PDB-style files is described here.)

Timeline for d1meoa_: