Lineage for d1meoa1 (1meo A:1-203)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129158Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 2129159Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 2129160Family c.65.1.1: Formyltransferase [53329] (5 protein domains)
  6. 2129167Protein Glycinamide ribonucleotide transformylase, GART [53330] (2 species)
  7. 2129189Species Human (Homo sapiens) [TaxId:9606] [82468] (27 PDB entries)
  8. 2129195Domain d1meoa1: 1meo A:1-203 [79035]
    Other proteins in same PDB: d1meoa2
    complexed with po4, so4

Details for d1meoa1

PDB Entry: 1meo (more details), 1.72 Å

PDB Description: human glycinamide ribonucleotide Transformylase at pH 4.2
PDB Compounds: (A:) Phosophoribosylglycinamide formyltransferase

SCOPe Domain Sequences for d1meoa1:

Sequence, based on SEQRES records: (download)

>d1meoa1 c.65.1.1 (A:1-203) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens) [TaxId: 9606]}
arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
lqlvasgtvqlgengkicwvkee

Sequence, based on observed residues (ATOM records): (download)

>d1meoa1 c.65.1.1 (A:1-203) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens) [TaxId: 9606]}
arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
heqaletgvtvtgctvhfvaeagqiilqeavpvkrgdtvatlservklaehkifpaalql
vasgtvqlgengkicwvkee

SCOPe Domain Coordinates for d1meoa1:

Click to download the PDB-style file with coordinates for d1meoa1.
(The format of our PDB-style files is described here.)

Timeline for d1meoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1meoa2