Lineage for d1menc1 (1men C:3-200)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468682Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 2468683Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 2468684Family c.65.1.1: Formyltransferase [53329] (5 protein domains)
  6. 2468691Protein Glycinamide ribonucleotide transformylase, GART [53330] (2 species)
  7. 2468713Species Human (Homo sapiens) [TaxId:9606] [82468] (27 PDB entries)
  8. 2468746Domain d1menc1: 1men C:3-200 [79034]
    Other proteins in same PDB: d1mena2, d1menb2, d1menc2
    complexed with gar

Details for d1menc1

PDB Entry: 1men (more details), 2.23 Å

PDB Description: complex structure of human GAR Tfase and substrate beta-GAR
PDB Compounds: (C:) phosphoribosylglycinamide formyltransferase

SCOPe Domain Sequences for d1menc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1menc1 c.65.1.1 (C:3-200) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens) [TaxId: 9606]}
vavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhklyk
nrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsnahe
qaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaalq
lvasgtvqlgengkicwv

SCOPe Domain Coordinates for d1menc1:

Click to download the PDB-style file with coordinates for d1menc1.
(The format of our PDB-style files is described here.)

Timeline for d1menc1: