SCOPe 2.07: Domain d1menb1: 1men B:3-200

Lineage for d1menb1 (1men B:3-200)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.65: Formyltransferase [53327] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest

4. Superfamily c.65.1: Formyltransferase [53328] (2 families)

5. Family c.65.1.1: Formyltransferase [53329] (5 proteins)

6. Protein Glycinamide ribonucleotide transformylase, GART [53330] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82468] (27 PDB entries)

8. Domain d1menb1: 1men B:3-200 [79033]
   Other proteins in same PDB: d1mena2, d1menb2, d1menc2
   complexed with gar

Details for d1menb1

PDB Entry: 1men, 2.23 Å

PDB Description: complex structure of human GAR Tfase and substrate beta-GAR

PDB Compounds: (B:) phosphoribosylglycinamide formyltransferase

SCOPe Domain Sequences for d1menb1:

Sequence; same for both SEQRES and ATOM records:

>d1menb1 c.65.1.1 (B:3-200) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens) [TaxId: 9606]}
vavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhklyk
nrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsnahe
qaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaalq
lvasgtvqlgengkicwv

Timeline for d1menb1:

• d1menb1 first appeared in SCOP 1.63, called d1menb_
  
• d1menb1 appears in SCOPe 2.06