Lineage for d1me7a1 (1me7 A:2-107,A:220-492)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080656Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2080657Family c.1.5.1: Inosine monophosphate dehydrogenase (IMPDH) [51413] (1 protein)
  6. 2080658Protein Inosine monophosphate dehydrogenase (IMPDH) [51414] (8 species)
  7. 2080683Species Tritrichomonas foetus [TaxId:5724] [51417] (10 PDB entries)
  8. 2080695Domain d1me7a1: 1me7 A:2-107,A:220-492 [79027]
    there two CBS domains in the disordered region 108-219
    complexed with k, moa, na, rvp

Details for d1me7a1

PDB Entry: 1me7 (more details), 2.15 Å

PDB Description: Inosine Monophosphate Dehydrogenase (IMPDH) From Tritrichomonas Foetus with RVP and MOA bound
PDB Compounds: (A:) inosine-5'-monophosphate dehydrogenase

SCOPe Domain Sequences for d1me7a1:

Sequence, based on SEQRES records: (download)

>d1me7a1 c.1.5.1 (A:2-107,A:220-492) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]}
akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
vsgekmaialareggisfifgsqsiesqaamvhavknfkagfvvsdXvchnelvdsqkry
lvgagintrdfrervpalveagadvlcidssdgfsewqkitigwirekygdkvkvgagni
vdgegfryladagadfikigigggsicitreqkgigrgqatavidvvaernkyfeetgiy
ipvcsdggivydyhmtlalamgadfimlgryfarfeesptrkvtingsvmkeywgegssr
arnwqrydlggkqklsfeegvdsyvpyagklkdnveaslnkvkstmcncgaltipqlqsk
akitlvssvsiveggahdvi

Sequence, based on observed residues (ATOM records): (download)

>d1me7a1 c.1.5.1 (A:2-107,A:220-492) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]}
akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
vsgekmaialareggisfifgsqsiesqaamvhavknfkagfvvsdXvchnelvdsqkry
lvgagintrdfrervpalveagadvlcidssdgfsewqkitigwirekygdkvkvgagni
vdgegfryladagadfikigigggsicitreqkgigrgqatavidvvaernkyfeetgiy
ipvcsdggivydyhmtlalamgadfimlgryfarfeesptrkvtingsvmkeywgegssr
arnwegvdsyvpyagklkdnveaslnkvkstmcncgaltipqlqskakitlvssvsiveg
gahdvi

SCOPe Domain Coordinates for d1me7a1:

Click to download the PDB-style file with coordinates for d1me7a1.
(The format of our PDB-style files is described here.)

Timeline for d1me7a1: