Lineage for d1mdxa_ (1mdx A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131690Family c.67.1.4: GABA-aminotransferase-like [53417] (17 protein domains)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2131802Protein Aminotransferase ArnB [82488] (1 species)
    4-amino-4-deoxy-L-arabinose liposaccharide modifying enzyme
  7. 2131803Species Salmonella typhimurium [TaxId:90371] [82489] (3 PDB entries)
  8. 2131805Domain d1mdxa_: 1mdx A: [79020]
    complexed with akg, gol, plp

Details for d1mdxa_

PDB Entry: 1mdx (more details), 1.96 Å

PDB Description: Crystal structure of ArnB transferase with pyridoxal 5' phosphate
PDB Compounds: (A:) ArnB aminotransferase

SCOPe Domain Sequences for d1mdxa_:

Sequence, based on SEQRES records: (download)

>d1mdxa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]}
dflpfsrpamgaeelaavktvldsgwittgpknqeleaafcrltgnqyavavssatagmh
ialmalgigegdevitpsmtwvstlnmivllganpvmvdvdrdtlmvtpehieaaitpqt
kaiipvhyagapadldaiyalgerygipviedaahatgtsykgrhigargtaifsfhaik
nitcaeggivvtdnpqfadklrslkfhglgvdawdrqsggrapqaevlapgykynlpdln
aaialaqlqkldalnarraaiaaqyhqamadlpfqplslpswehihawhlfiirvdearc
gitrdalmaslktkgigtglhfraahtqkyyrerfptltlpdtewnsericslplfpdmt
esdfdrvitalhqiag

Sequence, based on observed residues (ATOM records): (download)

>d1mdxa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]}
dflpfsrpamgaeelaavktvldsgwittgpknqeleaafcrltgnqyavavssatagmh
ialmalgigegdevitpsmtwvstlnmivllganpvmvdvdrdtlmvtpehieaaitpqt
kaiipvhyagapadldaiyalgerygipviedaahatgtsykgrhigargtaifsfhaik
nitcaeggivvtdnpqfadklrslkfhglgrapqaevlapgykynlpdlnaaialaqlqk
ldalnarraaiaaqyhqamadlpfqplslpswehihawhlfiirvdearcgitrdalmas
lktkgigtglhfraahtqkyyrerfptltlpdtewnsericslplfpdmtesdfdrvita
lhqiag

SCOPe Domain Coordinates for d1mdxa_:

Click to download the PDB-style file with coordinates for d1mdxa_.
(The format of our PDB-style files is described here.)

Timeline for d1mdxa_: