Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (7 proteins) |
Protein Actin [53073] (6 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [82437] (1 PDB entry) sequence identical to the rabbit actin |
Domain d1mdue2: 1mdu E:147-374 [79019] Other proteins in same PDB: d1mdua_, d1mdud_ |
PDB Entry: 1mdu (more details), 2.2 Å
SCOP Domain Sequences for d1mdue2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mdue2 c.55.1.1 (E:147-374) Actin {Chicken (Gallus gallus) [TaxId: 9031]} sgrttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvtta ereivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqp sfigmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapst mkikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhr
Timeline for d1mdue2:
View in 3D Domains from other chains: (mouse over for more information) d1mdua_, d1mdub1, d1mdub2, d1mdud_ |