Lineage for d1mdue2 (1mdu E:147-374)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 835946Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 835947Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 835948Protein Actin [53073] (6 species)
  7. 835954Species Chicken (Gallus gallus) [TaxId:9031] [82437] (1 PDB entry)
    sequence identical to the rabbit actin
  8. 835958Domain d1mdue2: 1mdu E:147-374 [79019]
    Other proteins in same PDB: d1mdua_, d1mdud_

Details for d1mdue2

PDB Entry: 1mdu (more details), 2.2 Å

PDB Description: Crystal structure of the chicken actin trimer complexed with human gelsolin segment 1 (GS-1)
PDB Compounds: (E:) a-actin

SCOP Domain Sequences for d1mdue2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mdue2 c.55.1.1 (E:147-374) Actin {Chicken (Gallus gallus) [TaxId: 9031]}
sgrttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvtta
ereivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqp
sfigmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapst
mkikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhr

SCOP Domain Coordinates for d1mdue2:

Click to download the PDB-style file with coordinates for d1mdue2.
(The format of our PDB-style files is described here.)

Timeline for d1mdue2: