SCOP 1.73: Domain d1mdue1: 1mdu E:7-146

Lineage for d1mdue1 (1mdu E:7-146)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Actin [53073] (6 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [82437] (1 PDB entry)
   sequence identical to the rabbit actin

8. Domain d1mdue1: 1mdu E:7-146 [79018]
   Other proteins in same PDB: d1mdua_, d1mdud_

Details for d1mdue1

PDB Entry: 1mdu, 2.2 Å

PDB Description: Crystal structure of the chicken actin trimer complexed with human gelsolin segment 1 (GS-1)

PDB Compounds: (E:) a-actin

SCOP Domain Sequences for d1mdue1:

Sequence, based on SEQRES records:

>d1mdue1 c.55.1.1 (E:7-146) Actin {Chicken (Gallus gallus) [TaxId: 9031]}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslya

Sequence, based on observed residues (ATOM records):

>d1mdue1 c.55.1.1 (E:7-146) Actin {Chicken (Gallus gallus) [TaxId: 9031]}
ttalvcdngsglvkagfagddapravfpsivgrprhqgqkdsyvgdeaqskrgiltlkyp
iehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvp
amyvaiqavlslya

Timeline for d1mdue1:

• d1mdue1 first appeared in SCOP 1.63
  
• d1mdue1 appears in SCOP 1.71
  
• d1mdue1 appears in SCOP 1.75
  
• d1mdue1 appears in the current release, SCOPe 2.08