SCOP 1.67: Domain d1mdub2: 1mdu B:147-375

Lineage for d1mdub2 (1mdu B:147-375)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Actin [53073] (6 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [82437] (1 PDB entry)
   sequence identical to the rabbit actin

8. Domain d1mdub2: 1mdu B:147-375 [79016]
   Other proteins in same PDB: d1mdua_, d1mdud_
   complexed with atp, ca, hic, trs

Details for d1mdub2

PDB Entry: 1mdu, 2.2 Å

PDB Description: Crystal structure of the chicken actin trimer complexed with human gelsolin segment 1 (GS-1)

SCOP Domain Sequences for d1mdub2:

Sequence; same for both SEQRES and ATOM records:

>d1mdub2 c.55.1.1 (B:147-375) Actin {Chicken (Gallus gallus)}
sgrttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvtta
ereivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqp
sfigmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapst
mkikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrk

Timeline for d1mdub2:

• d1mdub2 first appeared in SCOP 1.63
  
• d1mdub2 appears in SCOP 1.65
  
• d1mdub2 appears in SCOP 1.69
  
• d1mdub2 appears in the current release, SCOPe 2.08