Lineage for d1mdua_ (1mdu A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 609305Fold d.109: Gelsolin-like [55752] (2 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 609306Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 609307Family d.109.1.1: Gelsolin-like [55754] (4 proteins)
  6. 609308Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 609325Species Human (Homo sapiens) [TaxId:9606] [55761] (18 PDB entries)
  8. 609346Domain d1mdua_: 1mdu A: [79014]
    Other proteins in same PDB: d1mdub1, d1mdub2, d1mdue1, d1mdue2

Details for d1mdua_

PDB Entry: 1mdu (more details), 2.2 Å

PDB Description: Crystal structure of the chicken actin trimer complexed with human gelsolin segment 1 (GS-1)

SCOP Domain Sequences for d1mdua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mdua_ d.109.1.1 (A:) Gelsolin {Human (Homo sapiens)}
vvehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydl
hywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggv
asgf

SCOP Domain Coordinates for d1mdua_:

Click to download the PDB-style file with coordinates for d1mdua_.
(The format of our PDB-style files is described here.)

Timeline for d1mdua_: