Lineage for d1md2f_ (1md2 F:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296800Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 296865Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 296866Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 296867Protein Cholera toxin [50208] (1 species)
    barrel, partly opened; n*=5, S*=10
  7. 296868Species Vibrio cholerae [TaxId:666] [50209] (12 PDB entries)
  8. 296881Domain d1md2f_: 1md2 F: [79004]

Details for d1md2f_

PDB Entry: 1md2 (more details), 1.45 Å

PDB Description: cholera toxin b-pentamer with decavalent ligand bmsc-0013

SCOP Domain Sequences for d1md2f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1md2f_ b.40.2.1 (F:) Cholera toxin {Vibrio cholerae}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOP Domain Coordinates for d1md2f_:

Click to download the PDB-style file with coordinates for d1md2f_.
(The format of our PDB-style files is described here.)

Timeline for d1md2f_: