SCOPe 2.08: Domain d1md0b_: 1md0 B:

Lineage for d1md0b_ (1md0 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.21: ets domain [46859] (9 proteins)

6. Protein ETS-1 transcription factor, residues 331-440 [46862] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [46863] (7 PDB entries)
   Uniprot P27577 301-440

8. Domain d1md0b_: 1md0 B: [79001]
   has additional insertions and/or extensions that are not grouped together

Details for d1md0b_

PDB Entry: 1md0, 2 Å

PDB Description: crystal structure of an inhibited fragment of ets-1

PDB Compounds: (B:) c-ets-1 protein

SCOPe Domain Sequences for d1md0b_:

Sequence; same for both SEQRES and ATOM records:

>d1md0b_ a.4.5.21 (B:) ETS-1 transcription factor, residues 331-440 {Mouse (Mus musculus) [TaxId: 10090]}
pkgtfkdyvrdradlnkdkpvipaaalagytgsgpiqlwqfllelltdkscqsfiswtgd
gwefklsdpdevarrwgkrknkpkmnyeklsrglryyydkniihktagkryvyrfvcdlq
sllgytpeelhamldvkp

Timeline for d1md0b_:

• d1md0b_ first appeared in SCOP 1.63
  
• d1md0b_ appears in SCOPe 2.07