| Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) ![]() both pyridine (Pyr)- and pyrophosphate (PP)-binding modules have this fold conserved core consists of two Pyr and two PP-modules and binds two coenzyme molecules |
| Family c.36.1.1: Pyruvate oxidase and decarboxylase THDP-binding domains [52519] (4 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology |
| Protein Benzoylformate decarboxylase [52526] (1 species) |
| Species Pseudomonas putida [TaxId:303] [52527] (2 PDB entries) |
| Domain d1mczp3: 1mcz P:342-525 [78999] Other proteins in same PDB: d1mcza1, d1mczb1, d1mczc1, d1mczd1, d1mcze1, d1mczf1, d1mczg1, d1mczh1, d1mczi1, d1mczj1, d1mczk1, d1mczl1, d1mczm1, d1mczn1, d1mczo1, d1mczp1 complexed with mg, rmn, tdp |
PDB Entry: 1mcz (more details), 2.8 Å
SCOP Domain Sequences for d1mczp3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mczp3 c.36.1.1 (P:342-525) Benzoylformate decarboxylase {Pseudomonas putida}
epakvdqdagrlhpetvfdtlndmapenaiylneststtaqmwqrlnmrnpgsyyfcaag
glgfalpaaigvqlaeperqviavigdgsanysisalwtaaqyniptifvimnngtygal
rwfagvleaenvpgldvpgidfralakgygvqalkadnleqlkgslqealsakgpvliev
stvs
Timeline for d1mczp3:
View in 3DDomains from other chains: (mouse over for more information) d1mcza1, d1mcza2, d1mcza3, d1mczb1, d1mczb2, d1mczb3, d1mczc1, d1mczc2, d1mczc3, d1mczd1, d1mczd2, d1mczd3, d1mcze1, d1mcze2, d1mcze3, d1mczf1, d1mczf2, d1mczf3, d1mczg1, d1mczg2, d1mczg3, d1mczh1, d1mczh2, d1mczh3, d1mczi1, d1mczi2, d1mczi3, d1mczj1, d1mczj2, d1mczj3, d1mczk1, d1mczk2, d1mczk3, d1mczl1, d1mczl2, d1mczl3, d1mczm1, d1mczm2, d1mczm3, d1mczn1, d1mczn2, d1mczn3, d1mczo1, d1mczo2, d1mczo3 |