Lineage for d1mczn2 (1mcz N:2-181)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242757Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 242758Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) (S)
    both pyridine (Pyr)- and pyrophosphate (PP)-binding modules have this fold
    conserved core consists of two Pyr and two PP-modules and binds two coenzyme molecules
  5. 242759Family c.36.1.1: Pyruvate oxidase and decarboxylase THDP-binding domains [52519] (4 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 242770Protein Benzoylformate decarboxylase [52526] (1 species)
  7. 242771Species Pseudomonas putida [TaxId:303] [52527] (2 PDB entries)
  8. 242800Domain d1mczn2: 1mcz N:2-181 [78992]
    Other proteins in same PDB: d1mcza1, d1mczb1, d1mczc1, d1mczd1, d1mcze1, d1mczf1, d1mczg1, d1mczh1, d1mczi1, d1mczj1, d1mczk1, d1mczl1, d1mczm1, d1mczn1, d1mczo1, d1mczp1

Details for d1mczn2

PDB Entry: 1mcz (more details), 2.8 Å

PDB Description: benzoylformate decarboxylase from pseudomonas putida complexed with an inhibitor, r-mandelate

SCOP Domain Sequences for d1mczn2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mczn2 c.36.1.1 (N:2-181) Benzoylformate decarboxylase {Pseudomonas putida}
asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss

SCOP Domain Coordinates for d1mczn2:

Click to download the PDB-style file with coordinates for d1mczn2.
(The format of our PDB-style files is described here.)

Timeline for d1mczn2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mcza1, d1mcza2, d1mcza3, d1mczb1, d1mczb2, d1mczb3, d1mczc1, d1mczc2, d1mczc3, d1mczd1, d1mczd2, d1mczd3, d1mcze1, d1mcze2, d1mcze3, d1mczf1, d1mczf2, d1mczf3, d1mczg1, d1mczg2, d1mczg3, d1mczh1, d1mczh2, d1mczh3, d1mczi1, d1mczi2, d1mczi3, d1mczj1, d1mczj2, d1mczj3, d1mczk1, d1mczk2, d1mczk3, d1mczl1, d1mczl2, d1mczl3, d1mczm1, d1mczm2, d1mczm3, d1mczo1, d1mczo2, d1mczo3, d1mczp1, d1mczp2, d1mczp3