SCOPe 2.08: Domain d1mczm3: 1mcz M:342-525

Lineage for d1mczm3 (1mcz M:342-525)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology

6. Protein Benzoylformate decarboxylase [88756] (1 species)

7. Species Pseudomonas putida [TaxId:303] [88757] (7 PDB entries)
   Uniprot P20906

8. Domain d1mczm3: 1mcz M:342-525 [78990]
   Other proteins in same PDB: d1mcza1, d1mcza2, d1mczb1, d1mczb2, d1mczc1, d1mczc2, d1mczd1, d1mczd2, d1mcze1, d1mcze2, d1mczf1, d1mczf2, d1mczg1, d1mczg2, d1mczh1, d1mczh2, d1mczi1, d1mczi2, d1mczj1, d1mczj2, d1mczk1, d1mczk2, d1mczl1, d1mczl2, d1mczm1, d1mczm2, d1mczn1, d1mczn2, d1mczo1, d1mczo2, d1mczp1, d1mczp2
   complexed with mg, rmn, tdp

Details for d1mczm3

PDB Entry: 1mcz, 2.8 Å

PDB Description: benzoylformate decarboxylase from pseudomonas putida complexed with an inhibitor, r-mandelate

PDB Compounds: (M:) Benzoylformate decarboxylase

SCOPe Domain Sequences for d1mczm3:

Sequence; same for both SEQRES and ATOM records:

>d1mczm3 c.36.1.9 (M:342-525) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
epakvdqdagrlhpetvfdtlndmapenaiylneststtaqmwqrlnmrnpgsyyfcaag
glgfalpaaigvqlaeperqviavigdgsanysisalwtaaqyniptifvimnngtygal
rwfagvleaenvpgldvpgidfralakgygvqalkadnleqlkgslqealsakgpvliev
stvs

Timeline for d1mczm3:

• d1mczm3 first appeared in SCOP 1.63
  
• d1mczm3 appears in SCOPe 2.07