Lineage for d1mczk1 (1mcz K:182-341)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 312760Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 312761Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 312779Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (5 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 312786Protein Benzoylformate decarboxylase [52482] (1 species)
  7. 312787Species Pseudomonas putida [TaxId:303] [52483] (2 PDB entries)
  8. 312799Domain d1mczk1: 1mcz K:182-341 [78982]
    Other proteins in same PDB: d1mcza2, d1mcza3, d1mczb2, d1mczb3, d1mczc2, d1mczc3, d1mczd2, d1mczd3, d1mcze2, d1mcze3, d1mczf2, d1mczf3, d1mczg2, d1mczg3, d1mczh2, d1mczh3, d1mczi2, d1mczi3, d1mczj2, d1mczj3, d1mczk2, d1mczk3, d1mczl2, d1mczl3, d1mczm2, d1mczm3, d1mczn2, d1mczn3, d1mczo2, d1mczo3, d1mczp2, d1mczp3

Details for d1mczk1

PDB Entry: 1mcz (more details), 2.8 Å

PDB Description: benzoylformate decarboxylase from pseudomonas putida complexed with an inhibitor, r-mandelate

SCOP Domain Sequences for d1mczk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mczk1 c.31.1.3 (K:182-341) Benzoylformate decarboxylase {Pseudomonas putida}
svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd
pleaarapmgdaivadigamasalanlveessrqlptaap

SCOP Domain Coordinates for d1mczk1:

Click to download the PDB-style file with coordinates for d1mczk1.
(The format of our PDB-style files is described here.)

Timeline for d1mczk1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mcza1, d1mcza2, d1mcza3, d1mczb1, d1mczb2, d1mczb3, d1mczc1, d1mczc2, d1mczc3, d1mczd1, d1mczd2, d1mczd3, d1mcze1, d1mcze2, d1mcze3, d1mczf1, d1mczf2, d1mczf3, d1mczg1, d1mczg2, d1mczg3, d1mczh1, d1mczh2, d1mczh3, d1mczi1, d1mczi2, d1mczi3, d1mczj1, d1mczj2, d1mczj3, d1mczl1, d1mczl2, d1mczl3, d1mczm1, d1mczm2, d1mczm3, d1mczn1, d1mczn2, d1mczn3, d1mczo1, d1mczo2, d1mczo3, d1mczp1, d1mczp2, d1mczp3